PDB entry 1ktv

View 1ktv on RCSB PDB site
Description: Crystal Structure of Elongation Factor G Dimer Without Nucleotide
Class: translation
Keywords: apo form
Deposited on 2002-01-17, released 2003-12-23
The last revision prior to the SCOP 1.75 freeze date was dated 2003-12-23, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.8 Å
R-factor: 0.287
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor G
    Species: Thermus thermophilus
    Gene: fus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ktva1, d1ktva2, d1ktva3, d1ktva4
  • Chain 'B':
    Compound: Elongation factor G
    Species: Thermus thermophilus
    Gene: fus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ktvb1, d1ktvb2, d1ktvb3, d1ktvb4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ktvA (A:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktvA (A:)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ktvB (B:)
    mavkveydlkrlrnigiaahidagktttterilyytgrihkigevhegaatmdfmeqere
    rgititaavttcfwkdhriniidtpghvdftieversmrvldgaivvfdssqgvepqset
    vwrqaekykvpriafankmdktgadlwlvirtmqerlgarpvvmqlpigredtfsgiidv
    lrmkaytygndlgtdireipipeeyldqareyheklvevaadfdenimlkylegeeptee
    elvaairkgtidlkitpvflgsalknkgvqllldavvdylpspldippikgttpegevve
    ihpdpngplaalafkimadpyvgrltfirvysgtltsgsyvynttkgrkervarllrmha
    nhreeveelkagdlgavvglketitgdtlvgedaprvilesievpepvidvaiepktkad
    qeklsqalarlaeedptfrvsthpetgqtiisgmgelhleiivdrlkrefkvdanvgkpq
    vayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipkeyip
    avqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkgdpv
    ilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyatdlr
    sktqgrgsfvmffdhyqevpkqvqeklikgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktvB (B:)
    veydlkrlrnigiaahidagktttterilyytgriavttcfwkdhriniidtpghvdfti
    eversmrvldgaivvfdssqgvepqsetvwrqaekykvpriafankmdktgadlwlvirt
    mqerlgarpvvmqlpigredtfsgiidvlrmkaytygndlgtdireipipeeyldqarey
    heklvevaadfdenimlkylegeepteeelvaairkgtidlkitpvflgsalknkgvqll
    ldavvdylpspldippikgttpegevveihpdpngplaalafkimadpyvgrltfirvys
    gtltsgsyvynttkgrkervarllrmhanhreeveelkagdlgavvglketitgdtlvge
    daprvilidvaiepksqalarlaeedptfrvsthpqtiisgmgelhleiivdrlkrefvg
    kpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvipke
    yipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavqkg
    dpvilepimrvevttpeeymgdvigdlnarrgqilgmeprgnaqvirafvplaemfgyat
    dlrsktqgrgsfvmffdhyqevpkqvqeklik