PDB entry 1ktq

View 1ktq on RCSB PDB site
Description: dna polymerase
Deposited on 1995-08-16, released 1996-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 1996-11-08, with a file datestamp of 1996-11-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1ktq_ (-)
    spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
    gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
    erlfanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiar
    leaevfrlaghpfnlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpiv
    ekilqyreltklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtp
    lgqrirrafiaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgv
    preavdplmrraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiek
    tleegrrrgyvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklf
    prleemgarmllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwls
    ake
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktq_ (-)
    spkaleeapwpppegafvgfvlsrkepmwadllalaaarggrvhrapepykalrdlkear
    gllakdlsvlalreglglppgddpmllaylldpsnttpegvarryggewteeageraals
    erlfanlwgrlegeerllwlyreverplsavlahmeatgvrldvaylralslevaeeiar
    leaevfrlaghpfnlnsrdqlervlfdelglpaistsaavlealreahpivekilqyrel
    tklkstyidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirraf
    iaeegwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplm
    rraaktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrg
    yvetlfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgar
    mllqvhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake