PDB entry 1ktp

View 1ktp on RCSB PDB site
Description: Crystal structure of c-phycocyanin of synechococcus vulcanus at 1.6 angstroms
Class: photosynthesis
Keywords: cyanobacteria, photosynthesis, photosystem II, light harvesting proteins, thermostability
Deposited on 2002-01-17, released 2002-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.216
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-phycocyanin alpha subunit
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ktpa_
  • Chain 'B':
    Compound: c-phycocyanin beta subunit
    Species: Thermosynechococcus vulcanus [TaxId:32053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50033 (0-169)
      • modified residue (71)
    Domains in SCOPe 2.07: d1ktpb_
  • Heterogens: BLA, CYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktpA (A:)
    mktpiteaiaaadtqgrflsntelqavdgrfkravasmeaaraltnnaqslidgaaqavy
    qkfpytttmqgsqyastpegkakcardigyylrmityclvaggtgpmdeyliaglseins
    tfdlspswyiealkyikanhgltgqaaveanayidyainals
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktpB (B:)
    mldafakvvaqadargefltnaqfdalsnlvkegnkrldavnritsnastivanaaralf
    aeqpqliqpggnaytnrrmaaclrdmeiilryvtyailagdssvlddrclnglretyqal
    gtpgssvavaiqkmkdaaiaiandpngitpgdcsalmseiagyfdraaaava