PDB entry 1ktn

View 1ktn on RCSB PDB site
Description: Structural Genomics, Protein EC1535
Class: structural genomics, lyase
Keywords: BETA BARREL, STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, LYASE
Deposited on 2002-01-16, released 2002-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-deoxyribose-5-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ktna_
  • Chain 'B':
    Compound: 2-deoxyribose-5-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ktnb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktnA (A:)
    mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
    keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
    lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
    sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
    lasllkalgh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ktnB (B:)
    mtdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktl
    keqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfd
    lvkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpe
    sarimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassl
    lasllkalgh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktnB (B:)
    tdlkasslralklmdlttlndddtdekvialchqaktpvgntaaiciyprfipiarktlk
    eqgtpeiriatvtnfphgnddidialaetraaiaygadevdvvfpyralmagneqvgfdl
    vkackeacaaanvllkviietgelkdealirkaseisikagadfiktstgkvavnatpes
    arimmevirdmgvektvgfkpaggvrtaedaqkylaiadelfgadwadarhyrfgassll
    asllkalgh