PDB entry 1ktm

View 1ktm on RCSB PDB site
Description: solution structure of fat domain of focal adhesion kinase
Class: transferase
Keywords: Focal Adhesion Kinase, FAK, Focal Adhension Targeting Domain, FAT, NMR, Helix Bundle, TRANSFERASE
Deposited on 2002-01-16, released 2003-01-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Focal adhesion kinase 1
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q00944 (1-138)
    • initiating met (0)
  Domains in SCOPe 2.06: d1ktma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ktmA (A:)
  manldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslp
  vlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdakn
  lldvidqarlkmisqsrph