PDB entry 1ktm

View 1ktm on RCSB PDB site
Description: solution structure of fat domain of focal adhesion kinase
Class: transferase
Keywords: Focal Adhesion Kinase, FAK, Focal Adhension Targeting Domain, FAT, NMR, Helix Bundle
Deposited on 2002-01-16, released 2003-01-16
The last revision prior to the SCOP 1.73 freeze date was dated 2003-02-04, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Focal adhesion kinase 1
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q00944 (1-138)
      • initiating met (0)
    Domains in SCOP 1.73: d1ktma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktmA (A:)
    manldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslp
    vlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdakn
    lldvidqarlkmisqsrph