PDB entry 1ktm

View 1ktm on RCSB PDB site
Description: solution structure of fat domain of focal adhesion kinase
Deposited on 2002-01-16, released 2003-01-16
The last revision prior to the SCOP 1.65 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ktma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktmA (A:)
    manldrsndkvyenvtglvkaviemsskiqpappeeyvpmvkevglalrtllatvdeslp
    vlpasthreiemaqkllnsdlaelinkmklaqqyvmtslqqeykkqmltaahalavdakn
    lldvidqarlkmisqsrph