PDB entry 1ktj

View 1ktj on RCSB PDB site
Description: X-ray Structure Of Der P 2, The Major House Dust Mite Allergen
Class: allergen
Keywords: allergen, asthma, X-ray structure, immunoglobulin fold, hydrophobic cavity
Deposited on 2002-01-16, released 2002-05-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: allergen der p 2
    Species: Dermatophagoides pteronyssinus [TaxId:6956]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49278 (0-128)
      • engineered (0)
      • conflict (1)
    Domains in SCOPe 2.07: d1ktja_
  • Chain 'B':
    Compound: allergen der p 2
    Species: Dermatophagoides pteronyssinus [TaxId:6956]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P49278 (0-128)
      • engineered (0)
      • conflict (1)
    Domains in SCOPe 2.07: d1ktjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktjA (A:)
    sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
    levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
    iathakird
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktjB (B:)
    sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
    levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
    iathakird