PDB entry 1ktj

View 1ktj on RCSB PDB site
Description: x-ray structure of der p 2, the major house dust mite allergen
Deposited on 2002-01-16, released 2002-05-15
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-15, with a file datestamp of 2002-05-15.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.21
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ktja_
  • Chain 'B':
    Domains in SCOP 1.69: d1ktjb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktjA (A:)
    sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
    levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
    iathakird
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktjB (B:)
    sevdvkdcanheikkvlvpgchgsepciihrgkpfqleavfeanqntktakieikasidg
    levdvpgidpnachymkcplvkgqqydikytwnvpkiapksenvvvtvkvmgddgvlaca
    iathakird