PDB entry 1kth

View 1kth on RCSB PDB site
Description: the anisotropic refinement of kunitz type domain c5 at 0.95 angstrom
Deposited on 2002-01-16, released 2002-02-06
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-06, with a file datestamp of 2002-02-06.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.139
AEROSPACI score: 1.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1ktha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kthA (A:)
    etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv