PDB entry 1kth

View 1kth on RCSB PDB site
Description: The Anisotropic Refinement Of Kunitz Type Domain C5 at 0.95 Angstrom
Class: structural protein
Keywords: anisotropic refinement, kunitz inhibitor, extracellular matrix, connective tissue, structural protein
Deposited on 2002-01-16, released 2002-02-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.87 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Collagen alpha 3(VI) chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12111 (0-57)
  Domains in SCOPe 2.08: d1ktha_
• Heterogens: PO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kthA (A:)
  etdicklpkdegtcrdfilkwyydpntkscarfwyggcggnenkfgsqkecekvcapv