PDB entry 1kte

View 1kte on RCSB PDB site
Description: crystal structure of thioltransferase at 2.2 angstrom resolution
Class: electron transport
Keywords: redox-active center, electron transport, acetylation
Deposited on 1996-02-15, released 1996-10-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: thioltransferase
  Species: Sus scrofa [TaxId:9823]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12309 (0-104)
    • conflict (100)
    • conflict (103)
  Domains in SCOPe 2.07: d1ktea_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1kteA (A:)
  aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
  qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk