PDB entry 1kte

View 1kte on RCSB PDB site
Description: crystal structure of thioltransferase at 2.2 angstrom resolution
Class: electron transport
Keywords: redox-active center, electron transport, acetylation
Deposited on 1996-02-15, released 1996-10-14
The last revision prior to the SCOP 1.73 freeze date was dated 1996-10-14, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.189
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioltransferase
    Species: SUS SCROFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12309 (0-104)
      • conflict (100)
      • conflict (103)
    Domains in SCOP 1.73: d1ktea_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kteA (A:)
    aqafvnskiqpgkvvvfikptcpfcrktqellsqlpfkegllefvditatsdtneiqdyl
    qqltgartvprvfigkeciggctdlesmhkrgelltrlqqvgavk