PDB entry 1ktd

View 1ktd on RCSB PDB site
Description: crystal structure of class II MHC molecule iek bound to pigeon cytochrome c peptide
Class: immune system
Keywords: Protein-peptide complex, T cell receptor, antigen presentation, cytochrome
Deposited on 2002-01-15, released 2002-05-01
The last revision prior to the SCOP 1.75 freeze date was dated 2002-05-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.22
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, E-D alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ktda1, d1ktda2
  • Chain 'B':
    Compound: Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k
    Species: Columba livia and Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00021 (0-13)
      • engineered (11)
    • GB AAA39593 (30-214)
    Domains in SCOP 1.75: d1ktdb1, d1ktdb2
  • Chain 'C':
    Compound: H-2 class II histocompatibility antigen, E-D alpha chain
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ktdc1, d1ktdc2
  • Chain 'D':
    Compound: Fusion protein consisting of cytochrome C peptide, glycine rich linker, and MHC E-beta-k
    Species: Columba livia and Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00021 (0-13)
      • engineered (11)
    • GB AAA39593 (30-214)
    Domains in SCOP 1.75: d1ktdd1, d1ktdd2
  • Heterogens: NAG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdA (A:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdB (B:)
    aadliaylkqasakggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfyn
    leenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr
    rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
    tfqtlvmletvpqsgevytcqvehpsltdpvtvew
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdC (C:)
    ikeehtiiqaefyllpdkrgefmfdfdgdeifhvdieksetiwrleefakfasfeaqgal
    aniavdkanldvmkersnntpdanvapevtvlsrspvnlgepnilicfidkfsppvvnvt
    wlrngrpvtegvsetvflprddhlfrkfhyltflpstddfydcevdhwgleeplrktwef
    ee
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ktdD (D:)
    aadliaylkqasakggggslvgggsggggsrpwfleycksechfyngtqrvrllvryfyn
    leenlrfdsdvgefravtelgrpdaenwnsqpefleqkraevdtvcrhnyeifdnflvpr
    rveptvtvyptktqplehhnllvcsvsdfypgnievrwfrngkeektgivstglvrngdw
    tfqtlvmletvpqsgevytcqvehpsltdpvtvew