PDB entry 1ktc

View 1ktc on RCSB PDB site
Description: The Structure of alpha-N-Acetylgalactosaminidase
Class: hydrolase
Keywords: glycoprotein, (beta/alpha)8 barrel, protein-ligand complex, HYDROLASE
Deposited on 2002-01-15, released 2002-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.216
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-N-acetylgalactosaminidase
    Species: Gallus gallus [TaxId:9031]
    Gene: alpha-NAGA
    Database cross-references and differences (RAF-indexed):
    • PIR S43413 (0-End)
      • conflict (100)
    Domains in SCOPe 2.07: d1ktca1, d1ktca2
  • Heterogens: NAG, NGA, SO4, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ktcA (A:)
    lenglartppmgwlawerfrcnvncredprqcisemlfmemadriaedgwrelgykyini
    ddcwaakqrdaegrlvpdperfprgikaladyvharglklgiygdlgrltcggypgttld
    rveqdaqtfaewgvdmlkldgcyssgkeqaqgypqmaralnatgrpivyscswpayqggl
    ppkvnytllgeicnlwrnyddiqdswdsvlsivdwfftnqdvlqpfagpghwndpdmlii
    gnfglsyeqsrsqmalwtimaapllmstdlrtispsakkilqnrlmiqinqdplgiqgrr
    iikegshievflrplsqaasalvffsrrtdmpfryttslaklgfpmgaayevqdvysgki
    isglktgdnftviinpsgvvmwylcpkalliqqqapggpsrlpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ktcA (A:)
    lenglartppmgwlawerfrcnvncredprqcisemlfmemadriaedgwrelgykyini
    ddcwaakqrdaegrlvpdperfprgikaladyvharglklgiygdlgrltcggypgttld
    rveqdaqtfaewgvdmlkldgcyssgkeqaqgypqmaralnatgrpivyscswpayqggl
    ppkvnytllgeicnlwrnyddiqdswdsvlsivdwfftnqdvlqpfagpghwndpdmlii
    gnfglsyeqsrsqmalwtimaapllmstdlrtispsakkilqnrlmiqinqdplgiqgrr
    iikegshievflrplsqaasalvffsrrtdmpfryttslaklgfpmgaayevqdvysgki
    isglktgdnftviinpsgvvmwylcpka