PDB entry 1kt5

View 1kt5 on RCSB PDB site
Description: Crystal structure of bovine holo-RBP at pH 4.0
Class: transport protein
Keywords: RBP, retinol binding, TRANSPORT PROTEIN
Deposited on 2002-01-15, released 2003-06-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.161
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasma retinol-binding protein
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kt5a_
  • Heterogens: RTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kt5A (A:)
    erdcrvssfrvkenfdkarfagtwyamakkdpeglflqdnivaefsvdenghmsatakgr
    vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwiidtdyetfavqysc
    rllnldgtcadsysfvfardpsgfspevqkivrqrqeelclarqyrliphngycd