PDB entry 1kt1

View 1kt1 on RCSB PDB site
Description: Structure of the Large FKBP-like Protein, FKBP51, Involved in Steroid Receptor Complexes
Class: isomerase
Keywords: FKBP-like PPIase, TPR repeats, ISOMERASE
Deposited on 2002-01-14, released 2003-02-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.255
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FK506-binding protein FKBP51
    Species: Saimiri boliviensis [TaxId:27679]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1kt1a1, d1kt1a2, d1kt1a3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kt1A (A:)
    mttdegaknsrgnpaatvaeqgedvtskkdrgvlkivkrvghgeetpmigdrvyvhyngk
    langkkfdsshdrnepfvfsigkgqvikawdigvatmkkgeichllckpeyaygatgslp
    kipsnatlffevelldfkgedlledggiirrtkrrgegysnpnegarvqihlegrcggrv
    fdcrdvaftvgegedhdipigidkalekmqreeqcilhlgprygfgeagkpkfgiepnae
    liyevtlksfekakeswemdtkekleqaaivkekgtvyfkggkyvqaviqygkivswlem
    eyglsekeskasesfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgea
    qllmnefesakgdfekvlevnpqnkaarlqifmcqkkakehnerdrrtyanmfkkfaeqd
    akeeankamskktsegvtnekltashaveeekpeghv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kt1A (A:)
    kkdrgvlkivhgeetpmigdrvyvhyngklanpfvfsigkgqvikawdigvatmkkgeic
    hllcaygatgslpkipsnatlffevelldfkgedlledggiirrtkrrgegysnpnegar
    vqihlegrcggrvfdcrdvaftvgegedhdipigidkalekmqreeqcilhlgprygfge
    agkpkfgiepnaeliyevtlksfekakeswemdtkekleqaaivkekgtvyfkggkyvqa
    viqygkivswlemeyglsekeskasesfllaaflnlamcylklreytkaveccdkalgld
    sanekglyrrgeaqllmnefesakgdfekvlevnpqnkaarlqifmcqkkakehnerdrr
    tyanmfkkfaeqda