PDB entry 1kt0

View 1kt0 on RCSB PDB site
Description: Structure of the Large FKBP-like Protein, FKBP51, Involved in Steroid Receptor Complexes
Class: isomerase
Keywords: FKBP-like PPIASE, TPR repeats, ISOMERASE
Deposited on 2002-01-14, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.284
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 51 kda fk506-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FKBP5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13451
      • engineered (98)
    Domains in SCOPe 2.07: d1kt0a1, d1kt0a2, d1kt0a3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kt0A (A:)
    mttdegaknneesptatvaeqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgk
    lsngkkfdsshdrnepfvfslgkgqvikawdigvatmkrgeichllckpeyaygsagslp
    kipsnatlffeielldfkgedlfedggiirrtkrkgegysnpnegatveihlegrcggrm
    fdcrdvaftvgegedhdipigidkalekmqreeqcilylgprygfgeagkpkfgiepnae
    liyevtlksfekakeswemdtkekleqaaivkekgtvyfkggkymqaviqygkivswlem
    eyglsekeskasesfllaaflnlamcylklreytkaveccdkalgldsanekglyrrgea
    qllmnefesakgdfekvlevnpqnkaarlqismcqkkakehnerdrriyanmfkkfaeqd
    akeeankamgkktsegvtnekgtdsqameeekpeghv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kt0A (A:)
    vlkivtpmigdkvyvhykgklfdspfvfslgkgqvikawdigvatmkrgeichllckpey
    aygsagslpkipsnatlffeielldfkgedlfedggiirrtkrkgegysnpnegatveih
    legrcggrmfdcrdvaftvgegedhdipigidkalekmqreeqcilylgprygfgeagkp
    kfgiepnaeliyevtlksfekakeswemdtkekleqaaivkekgtvyfkggkymqaviqy
    gkivswlemeyglsekeskasesfllaaflnlamcylklreytkaveccdkalgldsane
    kglyrrgeaqllmnefesakgdfekvlevnaarlqismcqkkakehnerdrriyanm