PDB entry 1kt0

View 1kt0 on RCSB PDB site
Description: structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
Deposited on 2002-01-14, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.284
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kt0A (A:)
    vlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrnepfvfslgkgqvikawdi
    gvatmkrgeichllckpeyaygsagslpkipsnatlffeielldfkgedlfedggiirrt
    krkgegysnpnegatveihlegrcggrmfdcrdvaftvgegedhdipigidkalekmqre
    eqcilylgprygfgeagkpkfgiepnaeliyevtlksfekakeswemdtkekleqaaivk
    ekgtvyfkggkymqaviqygkivswlemeyglsekeskasesfllaaflnlamcylklre
    ytkaveccdkalgldsanekglyrrgeaqllmnefesakgdfekvlevnpqnkaarlqis
    mcqkkakehnerdrriyanm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kt0A (A:)
    vlkivtpmigdkvyvhykgklfdspfvfslgkgqvikawdigvatmkrgeichllckpey
    aygsagslpkipsnatlffeielldfkgedlfedggiirrtkrkgegysnpnegatveih
    legrcggrmfdcrdvaftvgegedhdipigidkalekmqreeqcilylgprygfgeagkp
    kfgiepnaeliyevtlksfekakeswemdtkekleqaaivkekgtvyfkggkymqaviqy
    gkivswlemeyglsekeskasesfllaaflnlamcylklreytkaveccdkalgldsane
    kglyrrgeaqllmnefesakgdfekvlevnaarlqismcqkkakehnerdrriyanm