PDB entry 1ksz

View 1ksz on RCSB PDB site
Description: entrapment of 6-thiophosphoryl-imp in the active site of crystalline adenylosuccinate synthetase from escherichia coli, data collected at 298k
Deposited on 1997-01-14, released 1997-10-08
The last revision prior to the SCOP 1.55 freeze date was dated 1997-10-08, with a file datestamp of 1997-10-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.171
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1ksz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ksz_ (-)
    gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
    renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
    rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
    vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
    snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
    tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
    aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
    etmilrdpfda