PDB entry 1ksw

View 1ksw on RCSB PDB site
Description: structure of human c-src tyrosine kinase (thr338gly mutant) in complex with n6-benzyl adp
Deposited on 2002-01-14, released 2002-02-27
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-27, with a file datestamp of 2002-02-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.231
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kswA (A:)
    ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
    qaeewyfgkitrreserlllnaenprgtflvresettkgayclsvsdfdnakglnvkhyk
    irkldsggfyitsrtqfnslqqlvayyskhadglchrlttvcptskpqtqglakdaweip
    reslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaflqeaqvmkklrheklv
    qlyavvseepiyivgeymskgslldflkgetgkylrlpqlvdmaaqiasgmayvermnyv
    hrdlraanilvgenlvckvadfglarliedneytarqgakfpikwtapeaalygrftiks
    dvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkep
    eerptfeylqafledyftstepqyqpgenl