PDB entry 1ksv

View 1ksv on RCSB PDB site
Description: structure of rsua
Deposited on 2002-01-14, released 2002-04-24
The last revision prior to the SCOP 1.71 freeze date was dated 2002-06-19, with a file datestamp of 2002-06-19.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.21
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ksvA (A:)
    gshmrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqq
    hgpryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqw
    shritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrlt
    isegryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv