PDB entry 1ksr

View 1ksr on RCSB PDB site
Description: the repeating segments of the f-actin cross-linking gelation factor (abp-120) have an immunoglobulin fold, nmr, 20 structures
Deposited on 1997-02-07, released 1997-08-20
The last revision prior to the SCOP 1.61 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1ksr__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ksr_ (-)
  adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
  gdgtydvefepkeagdyvinltldgdnvngfpktvtvkpa