PDB entry 1ksq

View 1ksq on RCSB PDB site
Description: nmr study of the third tb domain from latent transforming growth factor-beta binding protein-1
Deposited on 2002-01-14, released 2003-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2003-11-25, with a file datestamp of 2003-11-25.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1ksqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ksqA (A:)
  sadqpkeekkecyynlndaslcdnvlapnvtkqeccctsgagwgdnceifpcpvlgtaef
  temcpkgkgfvpage