PDB entry 1ksq

View 1ksq on RCSB PDB site
Description: NMR Study of the Third TB Domain from Latent Transforming Growth Factor-beta Binding Protein-1
Class: protein binding
Keywords: NMR structure, latent transforming growth factor-beta binding protein-1, LTBP-1, TGF-beta, TB domain, latency associated propeptide, LAP, PROTEIN BINDING
Deposited on 2002-01-14, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: latent transforming growth factor beta binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: LTBP1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22064 (2-74)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d1ksqa1, d1ksqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ksqA (A:)
  sadqpkeekkecyynlndaslcdnvlapnvtkqeccctsgagwgdnceifpcpvlgtaef
  temcpkgkgfvpage