PDB entry 1kso

View 1kso on RCSB PDB site
Description: crystal structure of apo s100a3
Class: metal binding protein
Keywords: S100,EF-hand,Ca2+ binding protein,Zn2+ binding protein, METAL BINDING PROTEIN
Deposited on 2002-01-14, released 2002-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-01, with a file datestamp of 2017-01-26.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: s100 calcium-binding protein a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ksoa_
  • Chain 'B':
    Compound: s100 calcium-binding protein a3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ksob_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ksoA (A:)
    marpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfms
    vldtnkdcevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ksoA (A:)
    arpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdcevdfveyvrslaclclycheyfkdcp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ksoB (B:)
    marpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfms
    vldtnkdcevdfveyvrslaclclycheyfkdcpseppcsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ksoB (B:)
    arpleqavaaivctfqeyagrcgdkyklcqaelkellqkelatwtptefrecdynkfmsv
    ldtnkdcevdfveyvrslaclclycheyfkdcp