PDB entry 1ksm

View 1ksm on RCSB PDB site
Description: average nmr solution structure of ca ln calbindin d9k
Deposited on 2002-01-14, released 2002-01-23
The last revision prior to the SCOP 1.61 freeze date was dated 2002-01-23, with a file datestamp of 2002-01-23.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.61: d1ksma_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1ksmA (A:)
  kspeelkgifekyaakegdpnqlskeelklllqtefpsllkgmstldelfeeldkngdge
  vsfeefqvlvkkisq