PDB entry 1ksk

View 1ksk on RCSB PDB site
Description: structure of rsua
Class: lyase
Keywords: Pseudouridine Synthase, rsuA, LYASE
Deposited on 2002-01-13, released 2002-04-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribosomal small subunit pseudouridine synthase a
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AA43 (3-233)
      • cloning artifact (3)
      • cloning artifact (3)
      • cloning artifact (3)
      • modified residue (3)
      • modified residue (66)
      • modified residue (113)
      • modified residue (191)
    Domains in SCOPe 2.08: d1kska3, d1kska4
  • Heterogens: URA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kskA (A:)
    gshmrldkfiaqqlgvsraiagreirgnrvtvdgeivrnaafkllpehdvaydgnplaqq
    hgpryfmlnkpqgyvcstddpdhptvlyfldepvawklhaagrldidttglvlmtddgqw
    shritsprhhcektylvtlespvaddtaeqfakgvqlhnekdltkpavlevitptqvrlt
    isegryhqvkrmfaavgnhvvelhreriggitldadlapgeyrplteeeiasvv