PDB entry 1ksj

View 1ksj on RCSB PDB site
Description: Complex of Arl2 and PDE delta, Crystal Form 2 (SeMet)
Class: signaling protein/hydrolase
Keywords: small GTPase, small GTP-binding protein, Arf family, effector molecule, immunoglobuline-like fold, GDI, SIGNALING PROTEIN-HYDROLASE COMPLEX
Deposited on 2002-01-13, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arf-like protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: ARL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D0J4
      • engineered (34)
    Domains in SCOPe 2.07: d1ksja_
  • Chain 'B':
    Compound: retinal rod rhodopsin-sensitive cgmp 3',5'-cyclic phosphodiesterase delta-subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D or PDED
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ksjb_
  • Heterogens: PO4, MG, BME, GDP, GTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ksjA (A:)
    gsmglltilkkmkqkerelrllmlgldnagkttilkkfngedvdtisptlgfniktlehr
    gfklniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlaga
    tllifankqdlpgalscnaiqealeldsirshhwriqgcsavtgedllpgidwllddiss
    rvftad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ksjA (A:)
    relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
    sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
    cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ksjB (B:)
    gsmsakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkcka
    vsrelnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmm
    pasvltgnviietkffdddllvstsrvrlfyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ksjB (B:)
    sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
    elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliepasvltgnvii
    etkffdddllvstsrvrlfyv