PDB entry 1ksh

View 1ksh on RCSB PDB site
Description: Complex of Arl2 and PDE delta, Crystal Form 2 (native)
Class: signaling protein/hydrolase
Keywords: small GTPase, small GTP-binding protein, Arf family, effector molecule, immunoglobuline-like fold, GDI, SIGNALING PROTEIN/HYDROLASE COMPLEX
Deposited on 2002-01-13, released 2002-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.244
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arf-like protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: ARL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D0J4
      • engineered (34)
      • modified residue (136)
    Domains in SCOPe 2.07: d1ksha_
  • Chain 'B':
    Compound: retinal rod rhodopsin-sensitive cgmp 3',5'-cyclic phosphodiesterase delta-subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE6D or PDED
    Database cross-references and differences (RAF-indexed):
    • Uniprot O43924 (Start-151)
      • modified residue (87)
    Domains in SCOPe 2.07: d1kshb_
  • Heterogens: MG, PO4, GDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kshA (A:)
    gsmglltilkkmkqkerelrllmlgldnagkttilkkfngedvdtisptlgfniktlehr
    gfklniwdvggqkslrsywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlaga
    tllifankqdlpgalscnaiqealeldsirshhwriqgcsavtgedllpgidwllddiss
    rvftad
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kshA (A:)
    relrllmlgldnagkttilkkfngedvdtisptlgfniktlehrgfklniwdvggqkslr
    sywrnyfestdgliwvvdsadrqrmqdcqrelqsllveerlagatllifankqdlpgals
    cnaiqealeldsirshhwriqgcsavtgedllpgidwllddissr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kshB (B:)
    gsmsakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkcka
    vsrelnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqslieaapesqmm
    pasvltgnviietkffdddllvstsrvrlfyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kshB (B:)
    sakderareilrgfklnwmnlrdaetgkilwqgtedlsvpgvehearvpkkilkckavsr
    elnfssteqmekfrleqkvyfkgqcleewffefgfvipnstntwqsliempasvltgnvi
    ietkffdddllvstsrvrlfyv