PDB entry 1ksd

View 1ksd on RCSB PDB site
Description: The structure of Endoglucanase from termite, Nasutitermes takasagoensis, at pH 6.5.
Deposited on 2002-01-12, released 2003-01-21
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-21, with a file datestamp of 2003-01-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.17
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1ksda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ksdA (A:)
    maydykqvlrdsllfyeaqrsgrlpadqkvtwrkdsalndqgdqgqdltggyfdagdfvk
    fgfpmaytatvlawglidfeagyssagalddgrkavkwatdyfikahtsqnefygqvgqg
    dadhafwgrpedmtmarpaykidtsrpgsdlagetaaalaaasivfrnvdgtysnnllth
    arqlfdfannyrgkysdsitdarnfyasadyrdelvwaaawlyratndntylntaeslyd
    efglqnwggglnwdskvsgvqvllakltnkqaykdtvqsyvnylinnqqktpkgllyidm
    wgtlrhaanaafimleaaelglsassyrqfaqtqidyalgdggrsfvcgfgsnpptrphh
    rssscppapatcdwntfnspdpnyhvlsgalvggpdqndnyvddrsdyvhnevatdynag
    fqsalaalvalgy