PDB entry 1ksc

View 1ksc on RCSB PDB site
Description: The structure of Endoglucanase from termite, Nasutitermes takasagoensis, at pH 5.6.
Class: hydrolase
Keywords: Cellulase, Endoglucanase, Termite, Nasutitermes takasagoensis, Glycosyl Hydrolase, Family 9, (Alpha/Alpha)6
Deposited on 2002-01-11, released 2003-01-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endo-b-1,4-glucanase
    Species: Nasutitermes takasagoensis [TaxId:62960]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O77044 (0-432)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1ksca1, d1ksca2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kscA (A:)
    maydykqvlrdsllfyeaqrsgrlpadqkvtwrkdsalndqgdqgqdltggyfdagdfvk
    fgfpmaytatvlawglidfeagyssagalddgrkavkwatdyfikahtsqnefygqvgqg
    dadhafwgrpedmtmarpaykidtsrpgsdlagetaaalaaasivfrnvdgtysnnllth
    arqlfdfannyrgkysdsitdarnfyasadyrdelvwaaawlyratndntylntaeslyd
    efglqnwggglnwdskvsgvqvllakltnkqaykdtvqsyvnylinnqqktpkgllyidm
    wgtlrhaanaafimleaaelglsassyrqfaqtqidyalgdggrsfvcgfgsnpptrphh
    rssscppapatcdwntfnspdpnyhvlsgalvggpdqndnyvddrsdyvhnevatdynag
    fqsalaalvalgy