PDB entry 1ks9

View 1ks9 on RCSB PDB site
Description: Ketopantoate Reductase from Escherichia coli
Class: oxidoreductase
Keywords: PanE, ApbA, KETOPANTOATE REDUCTASE, ROSSMAN FOLD, MONOMER, APO, OXIDOREDUCTASE
Deposited on 2002-01-11, released 2002-01-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.23
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydropantoate 2-reductase
    Species: Escherichia coli [TaxId:562]
    Gene: panE (apbA)
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1ks9a1, d1ks9a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ks9A (A:)
    mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
    latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
    aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklavn
    cvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidatae
    nissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkese