PDB entry 1ks2

View 1ks2 on RCSB PDB site
Description: crystal structure analysis of the rpia, structural genomics, protein ec1268.
Deposited on 2002-01-10, released 2002-08-14
The last revision prior to the SCOP 1.67 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.224
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ks2A (A:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ks2A (A:)
    tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
    slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
    qvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpia
    menainaipgvvtvglfanrgadvaligtpdgvktivk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ks2B (B:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ks2B (B:)
    tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
    slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
    qvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpia
    menainaipgvvtvglfanrgadvaligtpdgvktivk