PDB entry 1ks2

View 1ks2 on RCSB PDB site
Description: Crystal Structure Analysis of the rpiA, Structural Genomics, protein EC1268.
Class: Structural Genomics, ISOMERASE
Keywords: Structural Genomics, Isomerase, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2002-01-10, released 2002-08-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein EC1268, RPIA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z0 (Start-218)
      • modified residue (41)
      • modified residue (89)
      • modified residue (91)
      • modified residue (137)
      • modified residue (173)
      • modified residue (181)
    Domains in SCOPe 2.08: d1ks2a1, d1ks2a2
  • Chain 'B':
    Compound: protein EC1268, RPIA
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A7Z0 (Start-218)
      • modified residue (41)
      • modified residue (89)
      • modified residue (91)
      • modified residue (137)
      • modified residue (173)
      • modified residue (181)
    Domains in SCOPe 2.08: d1ks2b1, d1ks2b2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ks2A (A:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ks2A (A:)
    tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
    slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
    qvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpia
    menainaipgvvtvglfanrgadvaligtpdgvktivk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ks2B (B:)
    mtqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdastekl
    kslgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadas
    kqvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpi
    amenainaipgvvtvglfanrgadvaligtpdgvktivk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ks2B (B:)
    tqdelkkavgwaalqyvqpgtivgvgtgstaahfidalgtmkgqiegavsssdasteklk
    slgihvfdlnevdslgiyvdgadeinghmqmikgggaaltrekiiasvaekficiadask
    qvdilgkfplpvevipmarsavarqlvklggrpeyrqgvvtdngnvildvhgmeildpia
    menainaipgvvtvglfanrgadvaligtpdgvktivk