PDB entry 1ks0

View 1ks0 on RCSB PDB site
Description: The First Fibronectin Type II Module from Human Matrix Metalloproteinase 2
Class: hydrolase
Keywords: beta sheet, alpha helix, 3/1 helix, HYDROLASE
Deposited on 2002-01-10, released 2002-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: matrix metalloproteinase 2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08253 (3-End)
    • cloning artifact (0-2)
  Domains in SCOPe 2.07: d1ks0a1, d1ks0a2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1ks0A (A:)
  ripvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcpheal
  ftm
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1ks0A (A:)
  ripvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphea