PDB entry 1krw

View 1krw on RCSB PDB site
Description: solution structure and backbone dynamics of beryllofluoride-activated ntrc receiver domain
Class: signaling protein
Keywords: two component signal transduction, receiver domain, BeF3, phosphorylation, Bacterial nitrogen regulatory protein, SIGNALING PROTEIN
Deposited on 2002-01-10, released 2003-08-19
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogen regulation protein nr(I)
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1krwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1krwA (A:)
mqrgivwvvdddssirwvleralagagltcttfengnevlaalasktpdvllsdirmpgm
dglallkqikqrhpmlpviimtahsdldaavsayqqgafdylpkpfdideavalverais
hyqe