PDB entry 1krt

View 1krt on RCSB PDB site
Description: solution structure of the anticodon binding domain of escherichia coli lysyl-tRNA synthetase and studies of its interactions with tRNA-lys
Class: aminoacyl-tRNA synthetase
Keywords: aminoacyl-tRNA synthetase
Deposited on 1995-06-09, released 1995-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysyl-tRNA synthetase (product of lyss gene)
    Species: Escherichia coli [TaxId:562]
    Gene: LYSS CODONS 40 - 149
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1krta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1krtA (A:)
    aeqgiafpndfrrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlq
    dvggriqlyvarddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krtA (A:)
    frrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlqdvggriqlyv
    arddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka