PDB entry 1krs

View 1krs on RCSB PDB site
Description: solution structure of the anticodon binding domain of escherichia coli lysyl-trna synthetase and studies of its interactions with trna-lys
Deposited on 1995-06-09, released 1995-09-15
The last revision prior to the SCOP 1.63 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1krs__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1krs_ (-)
    frrdhtsdqlhaefdgkeneelealnievavagrmmtrrimgkasfvtlqdvggriqlyv
    arddlpegvyneqfkkwdlgdilgakgklfktktgelsihctelrlltka