PDB entry 1krn

View 1krn on RCSB PDB site
Description: structure of kringle 4 at 4c temperature and 1.67 angstroms resolution
Deposited on 1995-06-21, released 1997-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1krn__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1krn_ (-)
    vqdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadk
    gpwcfttdpsvrweycnlkkcsgteasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krn_ (-)
    dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
    wcfttdpsvrweycnlkkc