PDB entry 1krn

View 1krn on RCSB PDB site
Description: structure of kringle 4 at 4c temperature and 1.67 angstroms resolution
Deposited on 1995-06-21, released 1997-01-11
The last revision prior to the SCOP 1.55 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.147
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1krn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1krn_ (-)
  dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
  wcfttdpsvrweycnlkkc