PDB entry 1krn

View 1krn on RCSB PDB site
Description: structure of kringle 4 at 4c temperature and 1.67 angstroms resolution
Class: serine protease
Keywords: kringle, blood, plasminogen, serine protease
Deposited on 1995-06-21, released 1997-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.147
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: plasminogen
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1krna_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1krnA (A:)
    vqdcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadk
    gpwcfttdpsvrweycnlkkcsgteasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krnA (A:)
    dcyhgdgqsyrgtssttttgkkcqswssmtphrhqktpenypnagltmnycrnpdadkgp
    wcfttdpsvrweycnlkkc