PDB entry 1krm

View 1krm on RCSB PDB site
Description: crystal structure of bovine adenosine deaminase complexed with 6- hydroxyl-1,6-dihydropurine riboside
Deposited on 2002-01-10, released 2003-01-14
The last revision prior to the SCOP 1.65 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.196
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1krma_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1krmA (A:)
    aqtpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdf
    lakfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqae
    gdltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaid
    lagdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyh
    tledttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifk
    stldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmpspa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1krmA (A:)
    tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
    kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
    ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
    gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
    edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
    ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr