PDB entry 1krj

View 1krj on RCSB PDB site
Description: Engineering Calcium-binding site into Cytochrome c Peroxidase (CcP)
Class: oxidoreductase
Keywords: Cation-binding loop, Calcium selectivity, Trp191 cationic-radical, open/closed conformer, bidentate bond, pentagonal bipyrimidal geometry, lignin peroxidase, OXIDOREDUCTASE
Deposited on 2002-01-09, released 2002-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c peroxidase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: OPBYC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00431 (0-293)
      • engineered (175)
      • engineered (191)
      • engineered (193)
      • engineered (198)
      • engineered (200)
    Domains in SCOPe 2.05: d1krja_
  • Heterogens: K, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1krjA (A:)
    ttplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkh
    dntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemq
    gpkipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahtlgkt
    hlknsgyegpwdatnnvfdnsfylnllnedwklekndanneqwdsksgymmlptdysliq
    dpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl