PDB entry 1kra

View 1kra on RCSB PDB site
Description: crystal structure of klebsiella aerogenes urease, its apoenzyme and two active site mutants
Class: hydrolase (urea amido)
Keywords: apoenzyme, nickel metalloenzyme, hydrolase (urea amido)
Deposited on 1995-06-20, released 1995-10-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kraa_
  • Chain 'B':
    Compound: urease
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krab_
  • Chain 'C':
    Compound: urease
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1krac1, d1krac2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kraA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kraB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgplevnde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kraB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kraC (C:)
    msnisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqm
    laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia
    aegkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrm
    lqaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademd
    iqvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnp
    tlpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssd
    sqamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahe
    vgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgal
    gsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt
    yevrvdgelitsepadvlpmaqryflf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kraC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvchhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf