PDB entry 1kr7

View 1kr7 on RCSB PDB site
Description: Crystal structure of the nerve tissue mini-hemoglobin from the nemertean worm Cerebratulus lacteus
Class: oxygen storage/transport
Keywords: nerve tissue, mini-hemoglobin, protein cavities, Oxygen transport, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2002-01-09, released 2002-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural globin
    Species: CEREBRATULUS LACTEUS [TaxId:6221]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1kr7a_
  • Heterogens: SO4, ACT, HEM, OXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kr7A (A:)
    mvnwaavvddfyqelfkahpeyqnkfgfkgvalgslkgnaayktqagktvdyinaaiggs
    adaaglasrhkgrnvgsaefhnakaclakacsahgapdlghaiddilshl