PDB entry 1kr4

View 1kr4 on RCSB PDB site
Description: Structure Genomics, Protein TM1056, cutA
Class: structural genomics, unknown function
Keywords: cutA, structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2002-01-08, released 2002-08-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.218
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein TM1056, cutA
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0E6 (22-122)
      • expression tag (15-21)
      • modified residue (22)
      • see remark 999 (109)
      • modified residue (114)
      • cloning artifact (123-124)
    Domains in SCOPe 2.06: d1kr4a1, d1kr4a2, d1kr4a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1kr4A (A:)
mgsshhhhhhssgrealyfmghmilvystfpneekaleigrkllekrliacfnafeirsg
ywwkgeivqdkewaaifktteekekelyeelrklhpyetpaiftlkvenilteymnwlre
svlgs

    Sequence, based on observed residues (ATOM records): (download) 
    >1kr4A (A:)
alyfmghmilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaa
ifktteekekelyeelrklhpyetpaiftlkvenilteymnwlresvlgs