PDB entry 1kr4

View 1kr4 on RCSB PDB site
Description: structure genomics, protein tm1056, cuta
Deposited on 2002-01-08, released 2002-08-14
The last revision prior to the SCOP 1.69 freeze date was dated 2002-08-14, with a file datestamp of 2002-08-14.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.218
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1kr4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kr4A (A:)
    mgsshhhhhhssgrealyfmghmilvystfpneekaleigrkllekrliacfnafeirsg
    ywwkgeivqdkewaaifktteekekelyeelrklhpyetpaiftlkvenilteymnwlre
    svlgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr4A (A:)
    alyfmghmilvystfpneekaleigrkllekrliacfnafeirsgywwkgeivqdkewaa
    ifktteekekelyeelrklhpyetpaiftlkvenilteymnwlresvlgs