PDB entry 1kr2

View 1kr2 on RCSB PDB site
Description: crystal structure of human nmn/namn adenylyl transferase complexed with tiazofurin adenine dinucleotide (tad)
Class: transferase
Keywords: nucleotidyltransferase superfamily
Deposited on 2002-01-08, released 2003-01-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.203
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kr2a_
  • Chain 'B':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kr2b_
  • Chain 'C':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kr2c_
  • Chain 'D':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kr2d_
  • Chain 'E':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kr2e_
  • Chain 'F':
    Compound: nicotinamide mononucleotide adenylyl transferase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1kr2f_
  • Heterogens: TAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1kr2A (A:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr2A (A:)
    ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
    hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles
    favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis
    stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1kr2B (B:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr2B (B:)
    ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
    hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles
    favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis
    stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1kr2C (C:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr2C (C:)
    ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
    hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles
    favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis
    stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1kr2D (D:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr2D (D:)
    ektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipay
    hrvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadlles
    favpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandis
    stkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1kr2E (E:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr2E (E:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleaavpkvkllcgadllesf
    avpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandiss
    tkirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1kr2F (F:)
    mensektevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkgl
    ipayhrvimaelatknskwvevdtweslqkewketlkvlrhhqekleasdcdhqqnsptl
    erpgrkrkwtetqdssqkkslepktkavpkvkllcgadllesfavpnlwkseditqivan
    yglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisstkirralrrgqsirylv
    pdlvqeyiekhnlyssesedrnagvilaplqrntaeakt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1kr2F (F:)
    ktevvllacgsfnpitnmhlrlfelakdymngtgrytvvkgiispvgdaykkkglipayh
    rvimaelatknskwvevdtweslqkewketlkvlrhhqekleavpkvkllcgadllesfa
    vpnlwkseditqivanyglicvtragndaqkfiyesdvlwkhrsnihvvnewiandisst
    kirralrrgqsirylvpdlvqeyiekhnlyssesedrnagvilaplqrnta