PDB entry 1kr0

View 1kr0 on RCSB PDB site
Description: Hevamine Mutant D125A/Y183F in Complex with Tetra-NAG
Class: hydrolase
Keywords: hydrolase, chitinase/lysozyme
Deposited on 2002-01-08, released 2002-01-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.169
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hevamine a
    Species: Hevea brasiliensis [TaxId:3981]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot p23472 (0-272)
      • engineered (124)
      • engineered (182)
    Domains in SCOPe 2.05: d1kr0a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1kr0A (A:)
    ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
    sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
    gidfaiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
    qffnnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
    peikkspkyggvmlwskfyddkngysssildsv